PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.1G092500.1.p
Common NameLOC101757861, SETIT_017191mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 450aa    MW: 49130.8 Da    PI: 6.4517
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.1G092500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.33e-32269323155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k+rlrWt eLHerFveav++LGG+ekAtPk  l+lmkv+gLt++hvkSHLQkYR 
  Seita.1G092500.1.p 269 KTRLRWTLELHERFVEAVNKLGGPEKATPKGALKLMKVEGLTIYHVKSHLQKYRF 323
                         68****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.868266326IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.9E-29268324IPR009057Homeodomain-like
SuperFamilySSF466891.16E-16268323IPR009057Homeodomain-like
TIGRFAMsTIGR015577.7E-24269323IPR006447Myb domain, plants
PfamPF002491.5E-7271322IPR001005SANT/Myb domain
PfamPF143791.9E-21358404IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 450 aa     Download sequence    Send to blast
MSTQSIISVK QFAGPHRMAH TCTAPQPSAH NLLSAKSDNC GSAHDPQSSW AAVQTSSIKS  60
EMVGSLSLTK ILPFNLEKCS PGSNPDSAVS HVSQAELSDP VSSSSSTFCT SMFSSFQTNS  120
ESCRQKGALP FLPHPPKCEQ KLQQQISAGQ SSSSSSLLFG ADLRSGGHDD AGDLKDFLNL  180
SGDVSEGSFH GESSAMAFSE QMEFQFLSEQ LGIAITNNEE SPRLDDIYDR PLQTSSCPVP  240
SYSGQEDLPS AVSPVKVQLS SSRPEACNKT RLRWTLELHE RFVEAVNKLG GPEKATPKGA  300
LKLMKVEGLT IYHVKSHLQK YRFAKYLPET KEDKKSSSEG KKSQSAIPGN DAGKKSLQVA  360
EALRVQIEVQ KQLHEQLEVQ RQLQLRIEEH ARYLQKILEE QQKARNSLST TRNSAQEELP  420
ESTEKEETGM KVETSSEPLS RSKISDTDV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0383171e-152BT038317.1 Zea mays full-length cDNA clone ZM_BFb0227D23 mRNA, complete cds.
GenBankEU9545901e-152EU954590.1 Zea mays clone 1472551 hypothetical protein mRNA, complete cds.
GenBankJX4699781e-152JX469978.1 Zea mays subsp. mays clone UT3338 G2-like transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012698680.10.0PREDICTED: protein PHR1-LIKE 1-like
TrEMBLK3YSE70.0K3YSE7_SETIT; Uncharacterized protein
STRINGSi017191m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45263769
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.21e-60G2-like family protein